PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG126100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 363aa    MW: 40121.8 Da    PI: 6.3176
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG126100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS348.98.1e-107336215374
                 GRAS  15 gdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn...sseelaalklfsevsPilkfshltaNqa 101
                           d +la   L +++  as dgdp +R+a+yf+ ALa+rla       +  +ps+t+++    s+e +  +k++++++P+ kf+hltaNqa
  Pavir.9NG126100.1.p   3 ADPALAAVELVKVRAAASDDGDPAERVAFYFADALARRLAC-----GAGAQPSTTASDArfvSDELTLCYKTLNDACPYSKFAHLTANQA 87 
                          566788899999****************************8.....33334444443334668889999********************* PP

                 GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                          Ilea+ +++++Hi+Df+i qG+QW+aLlqaLa+Rpeg+p ++Ri gv sp  g   + +l +t  rL++fA+ lgv+fef + + + +++
  Pavir.9NG126100.1.p  88 ILEATGTATKIHIVDFGIVQGIQWAALLQALATRPEGKPsRVRISGVPSPYLGpkPAASLAATSARLRDFAKLLGVDFEFLP-LLRPVDE 176
                          ***********************************887769********998888999************************.599**** PP

                 GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                          l+ ++++v+p+Ea+aVn++lql++ll   ++++++ ++vL+l ksl+P vv++ e e+++n++ F++rf++al yy  +f+sl++ ++r+
  Pavir.9NG126100.1.p 177 LDRSDFSVEPDEAVAVNFMLQLYHLL---GDSDERVRRVLRLAKSLRPSVVTLGEYEVSLNRAGFVDRFANALCYYKPVFESLDVAMARD 263
                          **************************...55555566***************************************************** PP

                 GRAS 279 seerikvErellgreivnvva.cegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv.lgWkdr 365
                          s+er+ vEr ++g++i+ +v   egaer+ r+   ++W+  +e +GF+pv+ls++a +qa+ ll +++ +  y++ e   +++ l W++r
  Pavir.9NG126100.1.p 264 SSERVRVERCMFGERIRRAVGpEEGAERTDRMAASREWQTLMEWCGFEPVKLSNYARSQAEFLLWNYDaKYKYSLVELPPAFLsLAWEKR 353
                          ********************8356899*****************************************88889999*9999988****** PP

                 GRAS 366 pLvsvSaWr 374
                          pL++vSaWr
  Pavir.9NG126100.1.p 354 PLLTVSAWR 362
                          ********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.5921340IPR005202Transcription factor GRAS
PfamPF035142.8E-1043362IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
AAADPALAAV ELVKVRAAAS DDGDPAERVA FYFADALARR LACGAGAQPS TTASDARFVS  60
DELTLCYKTL NDACPYSKFA HLTANQAILE ATGTATKIHI VDFGIVQGIQ WAALLQALAT  120
RPEGKPSRVR ISGVPSPYLG PKPAASLAAT SARLRDFAKL LGVDFEFLPL LRPVDELDRS  180
DFSVEPDEAV AVNFMLQLYH LLGDSDERVR RVLRLAKSLR PSVVTLGEYE VSLNRAGFVD  240
RFANALCYYK PVFESLDVAM ARDSSERVRV ERCMFGERIR RAVGPEEGAE RTDRMAASRE  300
WQTLMEWCGF EPVKLSNYAR SQAEFLLWNY DAKYKYSLVE LPPAFLSLAW EKRPLLTVSA  360
WR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A0.0136215375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.221960.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7270220.0KJ727022.1 Zea mays clone pUT4003 GRAS transcription factor (GRAS65) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981941.10.0PREDICTED: scarecrow-like protein 4
SwissprotQ9FL031e-144SCL4_ARATH; Scarecrow-like protein 4
TrEMBLK4A7U80.0K4A7U8_SETIT; Uncharacterized protein
STRINGSi034954m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85693748
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.11e-132GRAS family protein